Every Goods Buy

Coupons, promo codes, discounts

RAXFLY Magnetic Charger USB Cable For iPhone 5 5S Lightning to USB Cable Magnet Charge Micro USB Type C Cable For Huawei P20 Pro

News

Tom Jones forced to cancel gig due to UK lightning storms

Tom Jones forced to cancel gig due to UK lightning storms

28.07.2018 - NME.com

Tom Jones cancelled his comeback concert in York last night (July 27) due to the extreme weather and lightning storms. The veteran singer had scheduled the comeback show due to a bout of illness which unfortunately was cancelled “given the atrocious...

Ebay

New OEM Original Apple iPhone 7 6S Plus 5 SE Lightning USB Cable Charger 2M/6FT

$6.99
Item condition: New
Time left: 12d

100% Genuine BRAND NEW Description: New OEM Authentic Original Lightning Cable USB Data Charger Authenticity is guaranteed Compatible models:iPhone XiPhone 8iPhone 8 Plus iPhone 7 Plus iPhone 7iPhone 6S PlusiPhone 6SiPhone 6 Plus iPhone 6iPhone 5SEiPhone 5S iPhone 5C iPhone 5 iPad 4 (4th Generation)iPad Air 1 2iPad Mini 1 2 3 4airiPad ProiPod Touch (5th Generation 16/32/64 GB)iPod Nano (7th...

2 Pack 10 Ft Lightning Cable Heavy Duty iPhone 8 7 6 plus Charger Charging Cord

$8.97
Item condition: New
Time left: 26d

2 Pack 10 Ft Lightning Cable Heavy Duty iPhone 8 7 6 plus Charger Charging Cord Product Description High quality design and High-quality materials to ensure reliability and provide super speed charging and transferring. Enhanced charging ports stress points for frequent plug and unplug. 5000+ times bent test with ensured long lifespan. Nylon braided: This nylon braided lightning cable is...

3 Pack 6 Ft Lightning Cable iPhone X 8 7 6 5 USB Charging Cord Heavy Charger New

$9.84
Item condition: New
Time left: 28d

Free shipping

3 Pack 6 Ft Lightning Cable iPhone X 8 7 6 5 USB Charging Cord Heavy Charger New AMAZING 3 Pack 6 Ft Lightning Cable If you have been looking for a high quality, Charging Cord USB Charger, your quest stops here! Universal Compatibility: iPhone X / 8 /8 Plus / 7 /7 Plus/ 6 /6S /S Plus /6S Plus / 5 /5S/ SE/ iPad Pro / iPad Air/ Air 2 / iPad Mini1 / mini 2 / mini 3/ mini 4 / iPod Touch 5th gen /...

Apple Lightning to 3.5 mm Headphone Jack Adapter Original OEM iPhone 7 8 Plus X

$9.97
Item condition: New
Time left: 20d

Free shipping

Apple Lightning to 3.5 mm Headphone Jack Adapter Original OEM iPhone 7 8 Plus X 100% Original AppleBRAND NEW 3.5mm headphone jack adapter endUSB lightning port endMMX62FE/A With the iPhone 7 and newer models, the 3.5mm headphone jack no longer exists. This adapter allows you to connect devices that use 3.5mm audio plugs to your Lightning devices. PAYMENT INFORMATION All orders are processed...

Lightning Cable 3/6/10FT MFi Certified Charger Cord for Apple iPhone 7 6s Plus 8

$9.99
Item condition: New
Time left: 24d

Free shipping

Apple MFi CertificateApple MFi certificate is a license which shown that Apple (Apple Inc.) has authorized accessory manufacturers to mark the MFi logo on their products. MFi is the abbreviation of Made for iPod, Made for iPhone, and Made for iPad. All Volts Lightning cables are MFi certified. Volts PPID number (verify on Apple MFi website): 140785-0391BulletpointsMFi Certified: Each cable is...

audioshow 2018 pestana palace hotel mbl monitoraudio ifi gryphon lucxar vyger metronome pass roksan ta ch audioquest thunder niagara powercable mainscable powerstrip

Photo Apple Lover on Flickr

Audioquest Niagara and Thunder

How to start, the ifi iUSB made a clear diference in the sound of the micro iDSD, then it came the ifi Gemini USB and made an improvement that is noticeable, USB cables make diference in sound, they are not cheap but...

audioshow 2018 pestana palace hotel mbl monitoraudio ifi gryphon lucxar vyger metronome pass roksan ta ch audioquest thunder niagara powercable mainscable powerstrip

Photo Apple Lover on Flickr

Audioquest Niagara and Thunder

How to start, the ifi iUSB made a clear diference in the sound of the micro iDSD, then it came the ifi Gemini USB and made an improvement that is noticeable, USB cables make diference in sound, they are not cheap but...

portable ordinateur specifications

Photo aladden_sima on Flickr

Asus N550JV Ordinateur Portable Avis

L'Asus N550JV est un portable de milieu de gamme performant, gâchée par un disque-dur abominable écran tactile d'affichage et de la tortue. Asus ordinateurs portables ont parcouru un long chemin depuis la série Eee...

h07 hardware snort2pf8 openbsd system managers manual snort2pf8name snort2pf turns snort an intrusion detection prevention systemsynopsis s seconds f filedescription daemon parses snorts alertfile blocks naughty hosts for specific amount time using pfctl you need anchor called etcpfconf anchorsnort2pfoptions how long should be blocked 1 hour file location varlogsnortalertexamples sudo usrlocalsbinsnort2pf 180 3 minutes secondsbugs known problems will only work with ipv4 ipv6 reactiveidssystemscanbequitecontroversalandrequirecarefulconfigurationoryoucanwindupavictimofyourownclevernesscaveatsasidebuddingbofhsshouldgivethisatry idpsinfo1 reference idpsinfo1name idpsinfo shows list currently by snort2pf8synopsis idpsinfodescription this little tool these bad reason why they anchorsnort2pfsee pfconf5 pfctl8 snort8 it is pretty easy gather status information from all sorts things ranging temperature your office number octets which have passed through fddi interface router but triv ial store data efficient systematic man ner where rrdtool kicks lets log analyze kinds datasources ds analysis part based ability quickly generate graphical representations values collected over definable period page find general design functionality round robin database more detailed description use individual functions check corre sponding introduction usage make sure rrdtutorial while pages talk command line switches set order important note that can remote controlled pipes saves considerable startup when plan do lot section remotecontrol further down there language bindings rrd allow directly perl python tcl php graph create stored one or several apart generating graphs extracted stdout rrdgraph dump contents plain ascii connection restore trans port architecture another1049 20040117 1rrdtool1 rrdtool1 rrddump xml format binary rrdrestore fetch get certain function uses retrieve its rrdfetch tune alter setup rrdtune last update rrdlast info display about rrdinfo rrdresize change size rras dangerous xport export retrieved rrdxport rrdcgi standalone producing fly does acquisition monitoring state con venient available constant interval unfortunately may always able exactly want therefore logfile any automatically interpo late value datasource lat est official timeslot write supplied well taken account interpolating next entry consolidation minute interested know development year could simply storing would take disk space wanted cover ing whole offers solution problem fea ture setting up define solidation occur what consolidation1049 2rrdtool1 cf average minimum maximum used build consolidated see rrdcreate dif ferent setups within maintained new loaded archives same rra very manner storage works like if 1000 val ues 5 allocate header area pointer telling was written archive guess limits his tory because single another 750 2 thus keeping two months although lower resolution guarantees grow old eliminated feature still keep gradually reducing along axis different consoli dation allows type actually interests traffic lan mini mum wine cellar total unknown mentioned earlier stores now happen no has possible other handles situations sup ported consolidating accumulated ready validity performed percentage new1049 3rrdtool1 below configurable level graphing reports numerical form rrds fully color tents defined freely control start option waits input via standard improve performance attaching process mrtg example accepts arguments completed print string ok followed timing uusertime ssystemtime both run ning totals since started error occurs printed abort possi ble follow linesee rrdupdate rrdxportbugs bugs features author tobias oetiker oetikereeethzch1049 rrdcreate1 rrdcreate1name databasesynopsis filename start|b step|s step dsdsnamedstheartbeatminmax rracfxffstepsrowsdescription files created final full filled name end extension however accept default 10s specifies 19700101 utc first added timed before specified atstyle specification documentation ways spec ify 300 base fed sources eg incoming outgoing communication configuration must some basic properties each source feed dsname particular 19 characters azaz09 dst defines howtomeasure insight following gauge temperatures people room redhat share1049 1rrdcreate1 counter continuous incrementing counters inoctets assumes never decreases except overflows takes overflow persec ond rate checks happened 32bit 64bit border acts accordingly adding appropriate result derive derivative going current useful gauges measure enter leaving internally without flow reset 32 64 bit might combine min absolute upon reading fast tend instead them normally after every read maximal count messages heartbeat pass between updates assumed expected range andor max outside regarded care u refer processed trafficcounter datarate device minimalmaximal prop erties help doing simple sanity running update1049 2rrdcreate1 rracfxffstepsrows purpose consists entered fit slots length becoming primary point consolida tion xff xfiles factor made steps many points then goes rows generations kept rrathe here explanation don baarda inner workings sort out popping databases gets samples arbitrary times builds pdps exact acceptable less than calculated applied longer entire considered sample such exceeding even rates during calculate pdp exceeds marked means mixture add enough exceed hence mark maxi the1049 3rrdcreate1 per obvi ously significant short unusual typical relative require multiple dont span extreme day case sin gle being donbaardabaesystemscomhow few hints meter really connected record together mail assume method mes sages transported mailserver give 65 look datatype moni toring second later stage question multiply math doubles precision amountsecond plot y tempted convert volume multiplying deltatime plots appro priate plotting volumes totalbytes sent received probably scale byteshour tool1049 4rrdcreate1 draws barplots clear gb days x bar dayexample temperaturerrd dstempgauge6002735000 rraaverage0511200 rramin05122400 rramax05122400 rraaver rrdtoolcreatetemperaturerrdstep300dstempgauge6002735000rraaverage0511200rramin05122400rramax05122400rraaverage05122400 sets 600 becomes 273 5000 areas 100 hours 1200 sec onds tem perature recorded 12 2400 third fourth respectivelyauthor rrdupdate1 rrdupdate1name rrdsynopsis template|t dsnameds n|timestampvaluevalue timestampvaluevalue feeds aligned according dsnamedsname expects resistant sending wrong template switch specify plate message updating acquired either letter n negative subtracted cur rent getting right especially working remaining elements argument were n01u1 dependent cho sen numeric modules impose their own parsing parameter colon remains separatorexample rrdtoolupdatedemo1rrdn344315u231049 20040301 1rrdupdate1 demo1rrd rrdtoolupdatedemo2rrd887457267u8874575212288745790327 demo2rrd three normal readings seems around secondsauthor rrdgraph1 rrdgraph1name sev eral s|start e|end x|xgrid xaxis grid label y|ygrid yaxis y|altygrid r|altymrtg a|altautoscale m|altautoscalemax n|nominor x|unitsexpo nent l|unitslength v|verticallabel text w|width pixels h|height i|interlaced f|imginfo matstring a|imgformat gif|png|gd b|background o|overlay u|unit z|lazy o|logarithmic u|upperlimit l|lowerlimit g|nolegend j|onlygraph f|forcerulesleg r|rigid s|step b|base c|color colortagrrggbb t|title title defvnamerrddsnamecf cdefvnamerpnexpression printvnamecfformat gprintvnamecfformat com menttext hrulevaluerrggbblegend vruletimerrggbblegend line{1|2|3}vnamerrggbblegend areavnamerrggbblegend stackvnamerrggbbleg enddescription main extract numeri cal puts gifs pngs recommended gif png enforce image output suppressed 40 2030 end1day begin epoch required numbers worth graphed time1049 20040406 1rrdgraph1 autoconfigure quite complex configure special needs rely autoconfiguration xgrid magic none configured gtmgstmtmmstltmlstlprlfm making labels g major m l idea tm say st additional items lpr strf lfm key words week month 10 utes definition minute10hour1hour10x mat we had 24 something monday mean morning 0000 positioned noon defining rather 86400 happens generated lctime environment variable locale prefer prior calling graph1049 2rrdgraph1 steplabel makes vertical lines appear inter gridstep showing ygrid word place dynamically algo rithm ensures too metric placed units contributed sasha mikheev nominor turn off minor particularly small cluttered travis brown mimics mrtgs rateupgenerated split 4 parts just rateup compute algorithm predefined ranges good cases fails miserably 260 sinx 250 almost straight altautoscale slightly periodic behavior seen modify affect wan compression throughput higher speed x|unitsexponent 10exponent scaling scaled appropri ate k etc wish dis play kilo 10e3 data1049 3rrdgraph1 mega 10e6 instance integer 18 inclusive exponent thousands 6 micro mil lionths prevent 9 character width left side 400 pixel drawing affects height false resulting interlaced most web browsers incremen tally load progressive scanned effect changes layout formatstring been printf similar parameters xsize ysize img tag suitable including imginfo srcimgs widthlu heightlu altdemo produce gd background beginning creation1049 4rrdgraph1 overlay white 255 transparent replacing corresponding unit displayed wise date existent located upper contains move upwards accommodate upperlimit event rigid limit bound exam ple keyword expand boundaries mode auto matically valid r disable memory network 1024 kb byte measurement kbs bs logarithmic colors override colortag sym bolic names back ground canvas shadea lefttop bor der shadeb rightbottom mgrid font frame arrow several1049 suppress generation legend render anything f|forceruleslegend force hrule vrule those drawn behaviour pre 1042 ver sions automatic calculates domain tries reso lution 3600 smaller silently ignored virtual explained def call chooses ideally represented chosen evaluating ematical expression reverse polish nota rpn ever traditional hp calculator already behind notation stack push onto execute operation neededtmpmanwpbjtu1605 52 pushing implicit pushed big incomprehensible maybe helps complete given vname321049 6rrdgraph1 vname32 vname operator pops divides pushes 15 expres sion rpnexpression cdef variables fol lowing operators applies selected stands modulo cos exp floor ceil lt le gt ge eq compares condition true otherwise b c d e presently pop selects lesser larger top respectively replaces above cdefaalpha limit1049 7rrdgraph1 dup exc manipulate duplicate exchange element having insufficient operations un unkn prev previous perform calculations across prevvname named cgetxmlextractcusrportsdevelgetxmlpatchescvsentries repository rootusrportsdevelgetxmlpkgcvs descr plistusrportsdevelgetxmlpkgcvsentries rootusrportsdevelgiblibcvs makefile distinfo patches pkgusrportsdevelgiblibcvsentries rootusrportsdevelgiblibpatchescvs patchmakefileinusrportsdevelgiblibpatchescvsentries rootusrportsdevelgiblibpkgcvs pfragshared plistusrportsdevelgiblibpkgcvsentries rootusrportsdevelgindentcvs pkgusrportsdevelgindentcvsentries rootusrportsdevelgindentpatchescvs patchdocmakefilein patchdocindenttexinfo patchmanmakefilein patchmantexinfo2manc patchsrcargsc patchsrcglobscusrportsdevelgindentpatchescvsentries rootusrportsdevelgindentpkgcvs plistusrportsdevelgindentpkgcvsentries rootusrportsdevelgladecvs pkgusrportsdevelgladecvsentries rootusrportsdevelgladepatchescvs patchconfigure patchltmainsh patchomfinstallmakefileinusrportsdevelgladepatchescvsentries rootusrportsdevelgladepkgcvs plistusrportsdevelgladepkgcvsentries rootusrportsdevelglibcvs pkgusrportsdevelglibcvsentries rootusrportsdevelglibpatchescvs patchmakefilein patchconfigurein patchdocsmakefilein patchglibconfigin patchglibh patchgmodulemakefilein patchgthreadmakefileinusrportsdevelglibpatchescvsentries rootusrportsdevelglibpkgcvs plistusrportsdevelglibpkgcvsentries rootusrportsdevelglib2cvs pkgusrportsdevelglib2cvsentries rootusrportsdevelglib2patchescvs patchglibmakefilein patchglibgbacktracec patchglibgconvertc patchglibgmacrosh patchglibgprintfc patchglibgstrfuncsc patchgobjectmakefilein patchgthreadmakefilein patchtestsmakefilein patchtestschildtestc patchtestsrefcountmakefilein patchtestsstrtodtestcusrportsdevelglib2patchescvsentries rootusrportsdevelglib2pkgcvs descrdocs plist plistdocsusrportsdevelglib2pkgcvsentries rootusrportsdevelglib2mmcvs pkgusrportsdevelglib2mmcvsentries rootusrportsdevelglib2mmpkgcvs plistdocsusrportsdevelglib2mmpkgcvsentries rootusrportsdevelgmakecvs pkgusrportsdevelgmakecvsentries rootusrportsdevelgmakepatchescvs patchdocmaketexi patchmake1usrportsdevelgmakepatchescvsentries rootusrportsdevelgmakepkgcvs plistusrportsdevelgmakepkgcvsentries rootusrportsdevelgmpcvs pkgusrportsdevelgmpcvsentries rootusrportsdevelgmppatchescvs patchconfigureusrportsdevelgmppatchescvsentries rootusrportsdevelgmppkgcvs plistusrportsdevelgmppkgcvsentries rootusrportsdevelgoopycvs pkgusrportsdevelgoopycvsentries rootusrportsdevelgoopypatchescvs patchgoopyfunctionalpyusrportsdevelgoopypatchescvsentries rootusrportsdevelgoopypkgcvs plistusrportsdevelgoopypkgcvsentries rootusrportsdevelgperfcvs pkgusrportsdevelgperfcvsentries rootusrportsdevelgperfpkgcvs plistusrportsdevelgperfpkgcvsentries rootusrportsdevelgputilscvs pkgusrportsdevelgputilscvsentries rootusrportsdevelgputilspatchescvs patchgpalanalyzec patchgpalcodegenc patchgpalscanc patchgpasmcodc patchgpasmdirectivec patchgpasmgpasmc patchgpasmlstc patchgpasmparsec patchgpasmtestsuitegpasmoldtestall patchgpasmutilc patchgplinkgplinkc patchgplinkmapc patchgputilsblockc patchgputilsdumph patchgputilsgpvcc patchincludestdhdrh patchlibgputilsgpcoffh patchlibgputilsgpdisc patchlibgputilsgpmessagec patchlibgputilsgpsystemc patchlibgputilsgpwritehexcpatchconfigureac patchgpalcodegen14c patchgpalgpalc patchgpalsymbolc patchgpasmcoffc patchgpasmevaluatec patchgpasmgperrorc patchgpasmmacroc patchgpasmscanl patchgpasmtestsuitetest patchgplinkcodc patchgplinklstc patchgplinkscanl patchgputilsdumpc patchgputilsgpdasmc patchgputilsgpvoc patchlibgputilsgparchivec patchlibgputilsgpcofflinkc patchlibgputilsgpdish patchlibgputilsgpreadobjc patchlibgputilsgpsystemh patchlibgputilsgpwriteobjcusrportsdevelgputilspatchescvsentries rootusrportsdevelgputilspkgcvs plistusrportsdevelgputilspkgcvsentries rootusrportsdevelgslcvs pkgusrportsdevelgslcvsentries rootusrportsdevelgslpatchescvs patchieeeutilsreadcusrportsdevelgslpatchescvsentries rootusrportsdevelgslpkgcvs plistusrportsdevelgslpkgcvsentries rootusrportsdevelgstreamercvs pkgusrportsdevelgstreamercvsentries rootusrportsdevelgstreamerpatchescvs patchgstcothreadscusrportsdevelgstreamerpatchescvsentries rootusrportsdevelgstreamerpkgcvs plistusrportsdevelgstreamerpkgcvsentries rootusrportsdevelgstreamerpluginscvs pkgusrportsdevelgstreamerpluginscvsentries rootusrportsdevelgstreamerpluginspatchescvs patchgconfmakefilein patchsyscdromgstcdplayerioctlbsdh patchsysossmakefilein patchsysossgstosselementc patchsysossossprobec patchsyssunaudiogstsunaudioc patchsyssunaudiogstsunaudiosrcc patchsyssunaudiogstsunmixercusrportsdevelgstreamerpluginspatchescvsentries rootusrportsdevelgstreamerpluginspkgcvs descra52 descraudiofile descrcdda descrdvdread descresd descrflac descrgnome descrjpeg descrlame descrmad descrmikmod descrmpeg2 descrogg descrsdl descrspeex descrvorbis plista52 plistaudiofile plistcdda plistdvdread plistesd plistflac plistgnome plistjpeg plistlame plistmad plistmikmod plistmpeg2 plistogg plistsdl plistspeex plistvorbisusrportsdevelgstreamerpluginspkgcvsentries rootusrportsdevelguilibcvs pkgusrportsdevelguilibcvsentries rootusrportsdevelguilibpatchescvs patchmakefileinusrportsdevelguilibpatchescvsentries rootusrportsdevelguilibpkgcvs plistusrportsdevelguilibpkgcvsentries rootusrportsdevelhaddockcvs pkgusrportsdevelhaddockcvsentries rootusrportsdevelhaddockpatchescvs patchmakefile patchconfigureusrportsdevelhaddockpatchescvsentries rootusrportsdevelhaddockpkgcvs plistusrportsdevelhaddockpkgcvsentries rootusrportsdevelhappycvs pkgusrportsdevelhappycvsentries rootusrportsdevelhappypatchescvs patchconfigureusrportsdevelhappypatchescvsentries rootusrportsdevelhappypkgcvs plistusrportsdevelhappypkgcvsentries rootusrportsdevelhelp2mancvs pkgusrportsdevelhelp2mancvsentries rootusrportsdevelhelp2manpatchescvs patchhelp2mantexiusrportsdevelhelp2manpatchescvsentries rootusrportsdevelhelp2manpkgcvs plistusrportsdevelhelp2manpkgcvsentries rootusrportsdevelhmakecvs pkgusrportsdevelhmakecvsentries rootusrportsdevelhmakepatchescvs patchscriptsharchusrportsdevelhmakepatchescvsentries rootusrportsdevelhmakepkgcvs plistusrportsdevelhmakepkgcvsentries rootusrportsdevelhordecvs pkgusrportsdevelhordecvsentries rootusrportsdevelhordepkgcvs plistusrportsdevelhordepkgcvsentries rootusrportsdevelhsportscvs pkgusrportsdevelhsportscvsentries rootusrportsdevelhsportspatchescvs patchmkconfigmkin patchpackageconfin patchportsconfigin patchteststestshusrportsdevelhsportspatchescvsentries rootusrportsdevelhsportspkgcvs plistusrportsdevelhsportspkgcvsentries rootusrportsdevelidutilscvs pkgusrportsdevelidutilscvsentries rootusrportsdevelidutilsfilescvs recompileusrportsdevelidutilsfilescvsentries rootusrportsdevelidutilspatchescvs patchlibmakefilein patchlibidumakefilein patchlispelispcomp patchm4makefileam patchm4makefileamin patchm4makefilein patchpomakefileinin patchsrcmakefileinusrportsdevelidutilspatchescvsentries rootusrportsdevelidutilspkgcvs plistusrportsdevelidutilspkgcvsentries rootusrportsdevelidoccvs pkgusrportsdevelidoccvsentries rootusrportsdevelidocpkgcvs plistusrportsdevelidocpkgcvsentries rootusrportsdeveljadcvs pkgusrportsdeveljadcvsentries rootusrportsdeveljadpkgcvs plistusrportsdeveljadpkgcvsentries rootusrportsdeveljakartaservletapicvs pkgusrportsdeveljakartaservletapicvsentries rootusrportsdeveljakartaservletapipkgcvs plistusrportsdeveljakartaservletapipkgcvsentries rootusrportsdeveljamcvs pkgusrportsdeveljamcvsentries rootusrportsdeveljampatchescvs patchjamfile patchjamh patchjambasecusrportsdeveljampatchescvsentries rootusrportsdeveljampkgcvs plistusrportsdeveljampkgcvsentries rootusrportsdeveljdk13 13linux 14 cvs javaportmkusrportsdeveljdk13cvs pkgusrportsdeveljdk13cvsentries rootusrportsdeveljdk13filescvs cacerts rtjarclasslist toolsjarclasslistusrportsdeveljdk13filescvsentries rootusrportsdeveljdk13patchescvs patchbinbootscript patchj2sdk131makecommonprogramgmk patchj2sdk131makejavaverifymakefile patchj2sdk131maketoolssanityck patchj2sdk131srcshareclassescomsuntoolsjavahresourcesopenbsdpowerpcproperties patchj2sdk131srcsharejavavmruntimejnic patchj2sdk131srcsharenativejavautilzipzlib113inflatec patchj2sdk131srcsolarisbinjavawrapperbsdsh patchj2sdk131srcsolarishpigreenthreadssrccontextc patchj2sdk131srcsolarishpigreenthreadssrcsysapitdc patchj2sdk131srcsolarishpisrcmemorymdc patchj2sdk131srcsolarisjavavmruntimeinvokenativearms patchj2sdk131srcsolarisnativecommonjlongmdhpackpatchj2sdk131buildbsdpowerpctmpjavajavalangjvmcclassheadersjavalangthreadh patchj2sdk131makecomsunjavahmakefile patchj2sdk131makejavahpinativemakefile patchj2sdk131makejavaxsoundmakefile patchj2sdk131srcbsdincludebsdmisch patchj2sdk131srcsharehpiincludehpiimplh patchj2sdk131srcsharenativejavautilzipinflaterc patchj2sdk131srcsharenativejavautilzipzlib113inftreesc patchj2sdk131srcsolarisbinrealpathsh patchj2sdk131srcsolarishpigreenthreadssrciomgrc patchj2sdk131srcsolarishpigreenthreadssrcthreadsmdc patchj2sdk131srcsolarisjavavmincludesysmacrosmdh patchj2sdk131srcsolarisjavavmruntimeinvokenativeppcs patchj2sdk131srcsolarisnativesunawtawtgraphicscpackpatchtoolong1 patchj2sdk131makecommondefsbsdgmk patchj2sdk131makejavajvmmakefile patchj2sdk131makesuncmmmakefile patchj2sdk131srcshareclassescomsuntoolsjavahresourcesopenbsdarmproperties patchj2sdk131srcsharejavavmruntimeclassresolverc patchj2sdk131srcsharenativejavautilzipzlib113infblockc patchj2sdk131srcsharenativejavautilzipzlib113zconfh patchj2sdk131srcsolarishpigreenthreadsincludecontextmdbsdh patchj2sdk131srcsolarishpigreenthreadssrcsignalsc patchj2sdk131srcsolarishpisrclinkermdc patchj2sdk131srcsolarisjavavmincludetypedefsmdh patchj2sdk131srcsolarisjavavmruntimejavaimdcusrportsdeveljdk13patchescvsentries rootusrportsdeveljdk13pkgcvs descrjre plistjreusrportsdeveljdk13pkgcvsentries rootusrportsdeveljdk13linuxcvs pkg systracepolicyusrportsdeveljdk13linuxcvsentries rootusrportsdeveljdk13linuxpatchescvs patchjrelibjvmcfgusrportsdeveljdk13linuxpatchescvsentries rootusrportsdeveljdk13linuxpkgcvs securityusrportsdeveljdk13linuxpkgcvsentries rootusrportsdeveljdk14cvs systracepolicy scsysmachdepctrapcvmmachdepcusrsrcsysarchalphaalphacvsentriesrepositoryusrsrcsysarchalphacompilecvsusrsrcsysarchalphacompilecvsentriesrepositoryusrsrcsysarchalphaconfcvsgenericmakefilealpharamdiskramdiskbramdiskbigfile usrsrcbincvsmakefilemakefileinccatchiochmodcpcshdatedddfdomainnameechoedexprhostnamekillkshlnlsmd5mkdirmtmvpaxpspwdrcprmrmailrmdirsleepsttysyncsystracetestusrsrcbincvsentriesrepositoryusrsrcbincatcvsmakefilecat1catcobjusrsrcbincatcv

Photo ssc on Flickr

geekroom-contest2-ssc

my room prepared for geekroom contest 2, 2002 😮 ... this photo here is also an experiment in stating the obvioius and adding lots of tags and notes

elements

Photo Alpat on Flickr

Kaiser Baas 1080P Sports Camera X80

Features: Full HD Resolution 1080p@30fps Waterproof In housing (provided), waterproof down to 30m. 2" LCD preview screen Review captured footage on the spot. Accessory kit: Mounts for your helmet, bicycle,...

Google Books

Lightning

Lightning

Bellwether Media. 2012

Lightning can strike trees and jump between clouds! Young readers will learn how lightning behaves, its relationship to thunder, and the ways to stay safe in its midst.

Lightning

Lightning

Courier Corporation. 2012

Revised, updated edition of classic work on the physics of lightning covers phenomena, terminology, measurement, photography, spectroscopy, thunder, and more, including reviews of recent research. 140 figures and tables.

Lightning

Lightning

Hachette UK. 2012

When the lightning strikes, everything changes... Lightning is a gripping thriller from Dean Koontz, the master of chilling suspense, that will thrill fans of Richard Laymon and Harlan Coben. 'Lightning sizzles. Wow! It's a mix to tingle any reader's fancy' - New York Daily News The first time the lightning strikes, Laura Shane is born... The second time is strikes the terror starts... though eight-year-old Laura is saved by a mysterious stranger from the perverted and deadly intentions of a...

RSS Fetcher

Lightning Safety Tips and Resources - weather.gov

US Dept of Commerce National Oceanic and Atmospheric Administration National Weather Service Safety 1325 East-West Hwy, 18th floor Communications Office

Lightning - Wikipedia

Lightning is not distributed evenly around the planet, as shown in the map. About 70% of lightning occurs over land in the tropics where atmospheric convection is the ...

Official Tampa Bay Lightning Website | NHL.com

The most up-to-date breaking news for the Tampa Bay Lightning including highlights, roster, schedule, scores and archives.

Real-Time Lightning Map :: LightningMaps.org

See lightning strikes in real time across the planet. Free access to maps of former thunderstorms. By Blitzortung.org and contributors.

Lightning Network

Powered by Blockchain Smart Contracts. Lightning is a decentralized network using smart contract functionality in the blockchain to enable instant payments across a ...

Twitter

“Ride the Lightning” was released #OnThisDay in 1984. What’s your favorite song on the album? https://t.co/tHKlLRezRT
27.07.2018 - @Metallica

34 years ago today, @Metallica unleashed Ride The Lightning! https://t.co/KJQQV6OW14
27.07.2018 - @MetalHammer

On this day in 1984, Metallica released 'Ride The Lightning'....

On this day in 1984, Metallica released 'Ride The Lightning'. https://t.co/K22xuUK0C4
27.07.2018 - @MonstersOfRock

RT @DonegalWeatherC: Very heavy rain now over Leinster tracking northwards over eastern Ulster and mid ulster with with the risk of Spot Fl…
28.07.2018 - @JohnJohnm53

RT @fullontwit: Wow, my @NissanEV_UK #LEAF just got struck by lightning ⚡ and this happened..... 20% to 100% instantly! (Yes I am kidd…
28.07.2018 - @TheEVside

Youtube

ULTIMATE CLOSE UP LIGHTNING COMPILATION

Close calls with lightning. Extremely close lightning strikes caught on video. Lightning hitting transformers. Transformers exploding. The best up close lightning ...

Lightning Strikes - Scary and Beautiful

Lightning is one of the most beautiful displays in nature. It is also one of the most deadly natural phenomena known to man. With bolt temperatures hotter than ...

What Happens When You're Struck By Lightning?

Getting stuck by lightning is rough. It can burn hotter than the sun, scar your body, and even blow off your clothes. Even worse, it kills about 47 Americans per ...

Leave a Reply

This site uses Akismet to reduce spam. Learn how your comment data is processed.